Cytokines Recombinant Proteins
Human Acrp30 Protein Recombinant Protein (RPPB5717)
- SKU:
- RPPB5717
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- Q15848
- Research Area:
- Cytokines
Description
| Product Name: | Human Acrp30 Protein Recombinant Protein |
| Product Code: | RPPB5717 |
| Size: | 25µg |
| Species: | Human |
| Target: | Acrp30 Protein |
| Synonyms: | Acrp30, AdipoQ, GBP-28, APM-1, ACDC. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered clear solution. |
| Formulation: | Acrp30 protein solution contains Phosphate buffered saline pH 7.4 and 1mM DTT. |
| Stability: | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time.�For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Purity: | Acrp30 purity is greater than 90% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN |
The adipose tissue exclusively expresses and secretes Adiponectin (Acrp30). Acrp30 is involved in various physiological processes such as energy homeostasis, insulin sensitivity, hormonal processes, fatty acid metabolism and obesity. Adiponectin circulates in the plasma. Decreased levels of Adiponectin are associated with insulin resistance and hyperinsulinemia, as seen in people with obesity insulin resistance, and diabetes type 2, whose plasma levels of adiponectin are reduced.The modular structure of Acrp30 is comprised of N-terminal collagenous domain followed by a C-terminal globular domain.Acrp30 also acts as a significant negative regulator in hematopoiesis and immune systems; it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin inhibits endothelial NF-kappa-b signaling through a cAMP-dependent pathway, it also inhibits TNF-alpha- induced expression of endothelial adhesion molecules.
The Adiponectin Human recombinant protein is a single, non-glycosilated polypeptide chain produced in E. coli, having a molecular weight of 25.1 kDa and containing 231 amino acids (15-244).
| UniProt Protein Function: | adiponectin: Important adipokine involved in the control of fat metabolism and insulin sensitivity, with direct anti-diabetic, anti-atherogenic and anti-inflammatory activities. Stimulates AMPK phosphorylation and activation in the liver and the skeletal muscle, enhancing glucose utilization and fatty-acid combustion. Antagonizes TNF-alpha by negatively regulating its expression in various tissues such as liver and macrophages, and also by counteracting its effects. Inhibits endothelial NF-kappa-B signaling through a cAMP-dependent pathway. May play a role in cell growth, angiogenesis and tissue remodeling by binding and sequestering various growth factors with distinct binding affinities, depending on the type of complex, LMW, MMW or HMW. Homomultimer. Forms trimers, hexamers and 12- to 18-mers. The trimers (low molecular weight complexes / LMW) are assembled via non-covalent interactions of the collagen-like domains in a triple helix and hydrophobic interactions within the globular C1q domain. Several trimers can associate to form disulfide-linked hexamers (middle molecular weight complexes / MMW) and larger complexes (higher molecular weight / HMW). The HMW-complex assembly may rely aditionally on lysine hydroxylation and glycosylation. LMW, MMW and HMW complexes bind to HBEGF, MMW and HMW complexes bind to PDGFB, and HMW complex binds to FGF2. Interacts with CTRP9A via the C1q domain (heterotrimeric complex). Synthesized exclusively by adipocytes and secreted into plasma. |
| UniProt Protein Details: | Protein type:Secreted, signal peptide; Endoplasmic reticulum; Secreted; Hormone Chromosomal Location of Human Ortholog: 3q27 Cellular Component: extracellular space; collagen; cell surface; endoplasmic reticulum; extracellular region Molecular Function:identical protein binding; protein binding; protein homodimerization activity; hormone activity; cytokine activity; sialic acid binding; receptor binding Biological Process: circadian rhythm; negative regulation of phagocytosis; negative regulation of MAP kinase activity; negative regulation of smooth muscle cell proliferation; negative regulation of hormone secretion; positive regulation of cellular protein metabolic process; response to glucocorticoid stimulus; membrane hyperpolarization; negative regulation of smooth muscle cell migration; glucose homeostasis; negative regulation of granulocyte differentiation; positive regulation of interleukin-8 production; positive regulation of glucose import; negative regulation of gluconeogenesis; response to glucose stimulus; adiponectin-mediated signaling pathway; negative regulation of protein amino acid autophosphorylation; negative regulation of blood pressure; negative regulation of cell migration; protein homooligomerization; response to nutrient; generation of precursor metabolites and energy; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of signal transduction; negative regulation of heterotypic cell-cell adhesion; glucose metabolic process; negative regulation of tumor necrosis factor production; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of fat cell differentiation; negative regulation of synaptic transmission; response to sucrose stimulus; membrane depolarization; positive regulation of peptidyl-tyrosine phosphorylation; response to ethanol; fatty acid beta-oxidation; positive regulation of fatty acid metabolic process; cellular response to insulin stimulus; negative regulation of macrophage differentiation; negative regulation of low-density lipoprotein receptor biosynthetic process; negative regulation of inflammatory response; brown fat cell differentiation; response to hypoxia; fatty acid oxidation; positive regulation of protein amino acid phosphorylation; response to activity; negative regulation of transcription, DNA-dependent; positive regulation of myeloid cell apoptosis; positive regulation of blood pressure Disease: Adiponectin, Serum Level Of, Quantitative Trait Locus 1 |
| NCBI Summary: | This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified. [provided by RefSeq, Apr 2010] |
| UniProt Code: | Q15848 |
| NCBI GenInfo Identifier: | 2493789 |
| NCBI Gene ID: | 9370 |
| NCBI Accession: | Q15848.1 |
| UniProt Secondary Accession: | Q15848,Q58EX9, |
| UniProt Related Accession: | Q15848 |
| Molecular Weight: | 25.1 kDa (231 aa) |
| NCBI Full Name: | Adiponectin |
| NCBI Synonym Full Names: | adiponectin, C1Q and collagen domain containing |
| NCBI Official Symbol: | ADIPOQ�� |
| NCBI Official Synonym Symbols: | ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1�� |
| NCBI Protein Information: | adiponectin |
| UniProt Protein Name: | Adiponectin |
| UniProt Synonym Protein Names: | 30 kDa adipocyte complement-related protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte, C1q and collagen domain-containing protein; Adipose most abundant gene transcript 1 protein; apM-1; Gelatin-binding protein |
| Protein Family: | Adiponectin |
| UniProt Gene Name: | ADIPOQ�� |
| UniProt Entry Name: | ADIPO_HUMAN |
Related Products
Human Acrp30 Recombinant Protein (RPPB0017)
Cytokines Recombinant Proteins
Human Acrp30 Recombinant Protein (RPPB0015)
Cytokines Recombinant Proteins
Human Acrp30 Recombinant Protein (RPPB0016)
Cytokines Recombinant Proteins
Human Acrp30 Recombinant Protein (RPPB0013)
Cytokines Recombinant Proteins
Human Acrp30 Recombinant Protein (RPPB0018)
Cytokines Recombinant Proteins